{"product_id":"proteintech-60908-3-ig","title":"Proteintech, 60908-3-Ig, EPHB2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPHB2 (60908-3-Ig) by Proteintech is a Monoclonal antibody targeting EPHB2 in WB, ELISA applications with reactivity to human, mouse, rat, pig, rabbit samples\n60908-3-Ig targets EPHB2 in WB, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Saos-2 cells, HeLa cells,  U2OS cells,  rat brain tissue,  mouse brain tissue,  rabbit brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEPHB2 is a receptor tyrosine kinase that mediates ephrin-dependent bidirectional signaling to control cell positioning, boundary formation, and tissue architecture. Expressed in the nervous system and intestinal epithelium, EPHB2 regulates axon guidance, synaptic plasticity, and epithelial organization. Loss or dysregulation of EPHB2 contributes to colorectal cancer progression and altered neural connectivity, underscoring its central role in developmental patterning and tissue homeostasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig, rabbit\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag28796 Product name: Recombinant human EPHB2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 886-986 aa of BC018763 Sequence: NPNSLKAMAPLSSGINLPLLDRTIPDYTSFNTVDEWLEAIKMGQYKESFANAGFTSFDVVSQMMMEDILRVGVTLAGHQKKILNSIQVMRAQMNQIQSVEG Predict reactive species\nFull Name: EPH receptor B2\nCalculated Molecular Weight: 987 aa, 108 kDa\nObserved Molecular Weight: 110-120 kDa\nGenBank Accession Number: BC018763\nGene Symbol: EPHB2\nGene ID (NCBI): 2048\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P29323\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888274919593,"sku":"60908-3-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-60908-3-ig","provider":"Iright","version":"1.0","type":"link"}