{"product_id":"proteintech-66010-1-ig","title":"Proteintech, 66010-1-Ig, DDB1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDB1 (66010-1-Ig) by Proteintech is a Monoclonal antibody targeting DDB1 in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n66010-1-Ig targets DDB1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  A549 cells,  HEK-293 cells,  Jurkat cells,  HSC-T6 cells,  PC-12 cells,  NIH\/3T3 cells,  RAW 264.7 cells\nPositive IHC detected in: human appendicitis tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDB1, also named as XAP1, XPCe, DDBa and XPE-BF, belongs to the DDB1 family. It is required for DNA repair. DDB1 binds to DDB2 to form the UV-damaged DNA-binding protein complex (the UV-DDB complex). The UV-DDB complex may recognize UV-induced DNA damage and recruit proteins of the nucleotide excision repair pathway (the NER pathway) to initiate DNA repair. The functional specificity of the DCX E3 ubiquitin-protein ligase complex is determined by the variable substrate recognition component recruited by DDB1. This antibody is specific to DDB1.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17903 Product name: Recombinant human DDB1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-400 aa of BC011686 Sequence: MSYNYVVTAQKPTAVNGCVTGHFTSAEDLNLLIAKNTRLEIYVVTAEGLRPVKEVGMYGKIAVMELFRPKGESKDLLFILTAKYNACILEYKQSGESIDIITRAHGNVQDRIGRPSETGIIGIIDPECRMIGLRLYDGLFKVIPLDRDNKELKAFNIRLEELHVIDVKFLYGCQAPTICFVYQDPQGRHVKTYEVSLREKEFNKGPWKQENVEAEASMVIAVPEPFGGAIIIGQESITYHNGDKYLAIAPPIIKQSTIVCHNRVDPNGSRYLLGDMEGRLFMLLLEKEEQMDGTVTLKDLRVELLGETSIAECLTYLDNGVVFVGSRLGDSQLVKLNVDSNEQGSYVVAMETFTNLGPIVDMCVVDLERQGQGQLVTCSGAFKEGSLRIIRNGIGIHEHA Predict reactive species\nFull Name: damage-specific DNA binding protein 1, 127kDa\nCalculated Molecular Weight: 1140 aa, 127 kDa\nObserved Molecular Weight: 127 kDa\nGenBank Accession Number: BC011686\nGene Symbol: DDB1\nGene ID (NCBI): 1642\nRRID: AB_10950859\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q16531\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888026538153,"sku":"66010-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66010-1-ig","provider":"Iright","version":"1.0","type":"link"}