{"product_id":"proteintech-66049-1-ig","title":"Proteintech, 66049-1-Ig, MMS19 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MMS19 (66049-1-Ig) by Proteintech is a Monoclonal antibody targeting MMS19 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human,  mouse,  rat samples\n66049-1-Ig targets MMS19 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human,  mouse,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells,  fetal human brain tissue,  HEK-293 cells,  HepG2 cells,  human brain tissue,  human kidney tissue,  NIH\/3T3 cells,  rat brain tissue,  RAW 264.7 cells\nPositive IP detected in: mouse brain tissue\nPositive IHC detected in: mouse testis tissue, human cervical cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Hela cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:20-1:200\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMMS19 (MMS19 nucleotide excision repair homolog), also known as MET18, is a 1,030 amino acid nuclear protein containing seven HEAT repeats that belongs to the MET18\/MMS19 family. Via its interactions with TFIIH p80 and TFIIH p89 helicases, MMS19 plays a role in nucleotide excision repair (NER) and RNA polymerase II (Pol II) transcription. MMS19 may also function as a transcriptional coactivator of estrogen receptor. While ubiquitously expressed, highest levels of MMS19 have been found in testis. At least five distinct MMS19 protein isoforms exist, which are produced by alternative splicing events.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8960 Product name: Recombinant human MMS19 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 457-803 aa of BC006575 Sequence: FLDGNVSFLPENSFPSRFQPFQDGSSGQRRLIALLMAFVCSLPRNVEIPQLNQLMRELLELSCCHSCPFSSTAAAKCFAGLLNKHPAGQQLDEFLQLAVDKVEAGLDSGPCRSQAFTLLLWVTKALVLRYHPLSSCLTARLMGLLSDPELGPAAADGFSLLMSDCTDVLTRAGHAEVRIMFRQRFFTDNVPALVQGFHAAPQDVKPNYLKGLSHVLNRLPKPVLLPELPTLLSLLLEALSCPDCVVQLSTLSCLQPLLLEAPQVMSLHVDTLVTKFLNLSSSPSMAVRIAALQCMHALTRLPTPVLLPYKPQVIRALAKPLDDKKRLVRKEAVSARGEWFLLGSPGS Predict reactive species\nFull Name: MMS19 nucleotide excision repair homolog (S. cerevisiae)\nCalculated Molecular Weight: 1030 aa, 113 kDa\nObserved Molecular Weight: 103 kDa, 38 kDa\nGenBank Accession Number: BC006575\nGene Symbol: MMS19\nGene ID (NCBI): 64210\nRRID: AB_11041708\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q96T76\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888015724713,"sku":"66049-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66049-1-ig","provider":"Iright","version":"1.0","type":"link"}