{"product_id":"proteintech-66063-1-ig","title":"Proteintech, 66063-1-Ig, NTF2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NTF2 (66063-1-Ig) by Proteintech is a Monoclonal antibody targeting NTF2 in WB, IHC, ELISA applications with reactivity to human samples\n66063-1-Ig targets NTF2 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Hela cells,  HepG2 cells,  human heart tissue\nPositive IHC detected in: human placenta tissue, human breast cancer tissue,  human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNUTF2 (nuclear transport factor 2), also named as NTF2, is a cytosolic protein responsible for nuclear import of Ran, a small Ras-like GTPase involved in a number of critical cellular processes, including cell cycle regulation, chromatin organization during mitosis, reformation of the nuclear envelope following mitosis, and controlling the directionality of nucleocytoplasmic transport. Nucleocytoplasmic translocation of NTF2 is regulated in mammalian cells, and may involve a tyrosine and\/or threonine kinase-dependent signal transduction mechanism(s) (PMID: 22880006). The MW of this protein is 14 kDa, and this antibody specially recognises the 14 kDa protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag7879 Product name: Recombinant human NUTF2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 10-127 aa of BC002348 Sequence: IGSSFIQHYYQLFDNDRTQLGAIYIDASCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSITAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHNFG Predict reactive species\nFull Name: nuclear transport factor 2\nCalculated Molecular Weight: 14 kDa\nObserved Molecular Weight: 13 kDa\nGenBank Accession Number: BC002348\nGene Symbol: NTF2\nGene ID (NCBI): 10204\nRRID: AB_11042770\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P61970\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888069562537,"sku":"66063-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66063-1-ig","provider":"Iright","version":"1.0","type":"link"}