{"product_id":"proteintech-66068-1-ig","title":"Proteintech, 66068-1-Ig, SRP9 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SRP9 (66068-1-Ig) by Proteintech is a Monoclonal antibody targeting SRP9 in WB, ELISA applications with reactivity to human, rat, mouse samples\n66068-1-Ig targets SRP9 in WB, ELISA applications and shows reactivity with human, rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HSC-T6 cells, HeLa cells,  HEK-293 cells,  ROS1728 cells,  NIH\/3T3 cells,  4T1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSignal recognition particle 9(SRP9) is component of the signal recognition particle (SRP), which is a ribonucleoprotein complex that mediates the targeting of proteins to the rough endoplasmic reticulum (ER). SRP9 form a heterodimer with SRP14, which involves in arrest of the elongation of the nescent chains during targeting to ensure efficient translocation of the preprotein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17153 Product name: Recombinant human SRP9 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-86 aa of BC015094 Sequence: MPQYQTWEEFSRAAEKLYLADPMKARVVLKYRHSDGNLCVKVTDDLVCLVYKTDQAQDVKKIEKFHSQLMRLMVAKEARNVTMETE Predict reactive species\nFull Name: signal recognition particle 9kDa\nCalculated Molecular Weight: 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC015094\nGene Symbol: SRP9\nGene ID (NCBI): 6726\nRRID: AB_11042618\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P49458\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888050327721,"sku":"66068-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66068-1-ig","provider":"Iright","version":"1.0","type":"link"}