{"product_id":"proteintech-66088-1-ig","title":"Proteintech, 66088-1-Ig, NCALD Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NCALD (66088-1-Ig) by Proteintech is a Monoclonal antibody targeting NCALD in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, pig, rat samples\n66088-1-Ig targets NCALD in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, pig, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: fetal human brain tissue, human brain tissue,  pig cerebellum tissue,  pig brain tissue,  rat brain tissue,  mouse brain tissue,  rat cerebellum tissue,  mouse cerebellum tissue\nPositive IHC detected in: human cerebellum tissue, mouse cerebellum tissue,  human testis tissue,  mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3200\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNCALD(Neurocalcin-delta) is a member of the EF-hand calcium-binding protein superfamily.It may be involved in the calcium-dependent regulation of rhodopsin phosphorylation.It is a high-affinity Ca2+ sensor (Kd of approx. 0.6 uM), which is most abundantly expressed in the Purkinje cells of the cerebellum(PMID:11964161).This antibody is specific to NCALD.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, pig, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18760 Product name: Recombinant human NCALD protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-193 aa of BC036098 Sequence: MGKQNSKLRPEVMQDLLESTDFTEHEIQEWYKGFLRDCPSGHLSMEEFKKIYGNFFPYGDASKFAEHVFRTFDANGDGTIDFREFIIALSVTSRGKLEQKLKWAFSMYDLDGNGYISKAEMLEIVQAIYKMVSSVMKMPEDESTPEKRTEKIFRQMDTNRDGKLSMEEFIRGAKSDPSIVRLLQCDPSSAGQF Predict reactive species\nFull Name: neurocalcin delta\nCalculated Molecular Weight: 193 aa, 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC036098\nGene Symbol: NCALD\nGene ID (NCBI): 83988\nRRID: AB_11232229\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P61601\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888302051497,"sku":"66088-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66088-1-ig","provider":"Iright","version":"1.0","type":"link"}