{"product_id":"proteintech-66097-1-ig","title":"Proteintech, 66097-1-Ig, ORM1\/2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ORM1\/2 (66097-1-Ig) by Proteintech is a Monoclonal antibody targeting ORM1\/2 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications with reactivity to human samples\n66097-1-Ig targets ORM1\/2 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human plasma tissue, HuH-7 cells,  human testis tissue\nPositive IHC detected in: human liver cancer tissue, human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\nPositive FC (Intra) detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:20000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:10-1:100\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.20 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAlpha-1-acid glycoprotein 1 (AGP1), also called orosomucoid-1 (ORM1), is a glycoprotein synthesized mostly by hepatocytes and present in human plasma. ORM1 is an acute-phase reactant protein controlled by glucocorticoids, interleukin-1 and interleukin-6, and increase up to 5-50 times upon infection and\/or inflammation. Anti-apoptotic effect and role as immunomodulator of ORM have been reported. ORM is an important carrier for synthetic drugs and influences their distribution and availability in the body. This antibody recognizes a band about 44 kDa in human plasma which may be due to the glycosylation of ORM1 or the dimer formation of the protein. This antibody recognizes both ORM1 and ORM2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19248 Product name: Recombinant human ORM1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 25-201 aa of BC026238 Sequence: NLVPVPITNATLDRITGKWFYIASAFRNEEYNKSVQEIQATFFYFTPNKTEDTIFLREYQTRQDQCIYNTTYLNVQRENGTISRYVGGQEHFAHLLILRDTKTYMLAFDVNDEKNWGLSVYADKPETTKEQLGEFYEALDCLRIPKSDVVYTDWKKDKCEPLEKQHEKERKQEEGES Predict reactive species\nFull Name: orosomucoid 1\nCalculated Molecular Weight: 201 aa, 24 kDa\nObserved Molecular Weight: 40-47 kDa\nGenBank Accession Number: BC026238\nGene Symbol: ORM1\nGene ID (NCBI): 5004\nRRID: AB_2881496\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P02763\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888069890217,"sku":"66097-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66097-1-ig","provider":"Iright","version":"1.0","type":"link"}