{"product_id":"proteintech-66098-1-ig","title":"Proteintech, 66098-1-Ig, S100A6 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe S100A6 (66098-1-Ig) by Proteintech is a Monoclonal antibody targeting S100A6 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n66098-1-Ig targets S100A6 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells\nPositive IHC detected in: human colon cancer tissue, human liver cancer tissue,  human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nS100A6 is also named as calcyclin, prolactin receptor-associated protein (PRA), growth factor-inducible protein 2A9 ir MLN4. It belongs to S100 family of low molecular weight, acidic, calcium-binding proteins which contain two EF-hand calcium binding sites. S100A6 may function as a calcium sensor to activate several processes in the calcium signal transduction pathway of cell growth, proliferation, secretion and exocytosis. Although S100A6 is a cytoplasmic protein, it can be located in the nuclear and cytoplasmic membranes in the presence of Ca2+ (PMID: 37670392).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17606 Product name: Recombinant human S100A6 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-90 aa of BC001431 Sequence: MACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLDRNKDQEVNFQEYVTFLGALALIYNEALKG Predict reactive species\nFull Name: S100 calcium binding protein A6\nCalculated Molecular Weight: 10 kDa\nObserved Molecular Weight: 10 kDa\nGenBank Accession Number: BC001431\nGene Symbol: S100A6\nGene ID (NCBI): 6277\nRRID: AB_2881497\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P06703\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888074576041,"sku":"66098-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66098-1-ig","provider":"Iright","version":"1.0","type":"link"}