{"product_id":"proteintech-66133-1-ig","title":"Proteintech, 66133-1-Ig, Pancreatic alpha-amylase Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Pancreatic alpha-amylase (66133-1-Ig) by Proteintech is a Monoclonal antibody targeting Pancreatic alpha-amylase in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, rat, pig samples\n66133-1-Ig targets Pancreatic alpha-amylase in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human saliva,   tissue,  pig pancreas tissue,  rat pancreas tissue\nPositive IHC detected in: human pancreas cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: BxPC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:600-1:2400\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe complete human amylase gene contains five intact genes: two pancreatic genes (AMY2A and AMY2B) and three salivary genes (AMYIA, AMYIB, and AMYIC). AMY2A(Pancreatic alpha-amylase)is also named as PA and is a 56 kDa protein consisting of 496 amino acids in a single polypeptide chain, folded into three domains(PMID:10657258). It has a hydrolase activity acting on glycosyl bonds. AMY2A and AMY2B transcripts are present in the human pancreas but not in the parotid salivary gland, while AMY1 transcripts are present in the parotid gland but not in the pancreas(PMID:1692956).This antibody can recognize amylase alpha.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, pig\nCited Reactivity: human, pig\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8819 Product name: Recombinant human AMY2A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 162-511 aa of BC007060 Sequence: DIENYNDATQVRDCRLTGLLDLALEKDYVRSKIAEYMNHLIDIGVAGFRLDASKHMWPGDIKAILDKLHNLNSNWFPAGSKPFIYQEVIDLGGEPIKSSDYFGNGRVTEFKYGAKLGTVIRKWNGEKMSYLKNWGEGWGFVPSDRALVFVDNHDNQRGHGAGGASILTFWDARLYKMAVGFMLAHPYGFTRVMSSYRWPRQFQNGNDVNDWVGPPNNNGVIKEVTINPDTTCGNDWVCEHRWRQIRNMVIFRNVVDGQPFTNWYDNGSNQVAFGRGNRGFIVFNNDDWSFSLTLQTGLPAGTYCDVISGDKINGNCTGIKIYVSDDGKAHFSISNSAEDPFIAIHAESKL Predict reactive species\nFull Name: amylase, alpha 2A (pancreatic)\nCalculated Molecular Weight: 511 aa, 58 kDa\nObserved Molecular Weight: 58 kDa\nGenBank Accession Number: BC007060\nGene Symbol: Amylase Alpha\nGene ID (NCBI): 279\nRRID: AB_2881532\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P04746\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888022376617,"sku":"66133-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66133-1-ig","provider":"Iright","version":"1.0","type":"link"}