{"product_id":"proteintech-66141-1-ig","title":"Proteintech, 66141-1-Ig, AEBP2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe AEBP2 (66141-1-Ig) by Proteintech is a Monoclonal antibody targeting AEBP2 in WB, ELISA applications with reactivity to human, pig samples\n66141-1-Ig targets AEBP2 in WB, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAEBP2 belongs to the AEBP2\/jing C2H2-type zinc-finger family. It is a DNA-binding transcriptional repressor. AEBP2 is a zinc finger protein that has been shown to interact with the mammalian Polycomb Repression Complex 2 (PRC2). It may interact with and stimulate the activity of the PRC2 complex, which methylates 'Lys-9' and 'Lys-27' residues of histone H3. AEBP2 is an evolutionarily well-conserved gene that is found in the animals ranging from flying insects to mammals. (PMID:19293275) The antibody recognizes adult-specific larger form (52 kDa) and the embryo-specific smaller form (31 kDa).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17905 Product name: Recombinant human AEBP2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-295 aa of BC015624 Sequence: MSSDGEPLSRMDSEDSISSTIMDVDSTISSGRSTPAMMNGQGSTTSSSKNIAYNCCWDQCQACFNSSPDLADHIRSIHVDGQRGGVFVCLWKGCKVYNTPSTSQSWLQRHMLTHSGDKPFKCVVGGCNASFASQGGLARHVPTHFSQQNSSKVSSQPKAKEESPSKAGMNKRRKLKNKRRRSLPRPHDFFDAQTLDAIRHRAICFNLSAHIESLGKGHSVVFHSTVIAKRKEDSGKIKLLLHWMPEDILPDVWVNESERHQLKTKVVHLSKLPKDTALLLDPNIYRTMPQKRLKR Predict reactive species\nFull Name: AE binding protein 2\nCalculated Molecular Weight: 33 kDa, 54 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC015624\nGene Symbol: AEBP2\nGene ID (NCBI): 121536\nRRID: AB_2881538\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q6ZN18\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888085160105,"sku":"66141-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66141-1-ig","provider":"Iright","version":"1.0","type":"link"}