{"product_id":"proteintech-66143-1-ig","title":"Proteintech, 66143-1-Ig, IL-17D Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-17D (66143-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-17D in WB, ELISA applications with reactivity to human samples\n66143-1-Ig targets IL-17D in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Recombinant protein, Recombinant protein protein\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIL17D is a secreted cytokine with homology to the IL-17 family of proteins. IL17D is preferentially expressed in skeletal muscle, brain, adipose tissue, heart, lung, and pancreas. The treatment of endothelial cells with IL17D has been shown to stimulate the production of other cytokines including IL6, IL8 and CSF2\/ GM-CSF. The increased expression of IL8 induced by IL17D was found to be NF-kappa B-dependent.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6762 Product name: Recombinant human IL-17D protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-202 aa of BC036243 Sequence: MLVAGFLLALPPSWAAGAPRAGRRPARPRGCADRPEELLEQLYGRLAAGVLSAFHHTLQLGPREQARNASCPAGGRPADRRFRPPTNLRSVSPWAYRISYDPARYPRYLPEAYCLCRGCLTGLFGEEDVRFRSAPVYMPTVVLRRTPACAGGRSVYTEAYVTIPVGCTCVPEPEKDADSINSSIDKQGAKLLLGPNDAPAGP Predict reactive species\nFull Name: interleukin 17D\nCalculated Molecular Weight: 22 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC036243\nGene Symbol: IL-17D\nGene ID (NCBI): 53342\nRRID: AB_2881540\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8TAD2\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888029585577,"sku":"66143-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66143-1-ig","provider":"Iright","version":"1.0","type":"link"}