{"product_id":"proteintech-66156-1-ig","title":"Proteintech, 66156-1-Ig, Ceruloplasmin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Ceruloplasmin (66156-1-Ig) by Proteintech is a Monoclonal antibody targeting Ceruloplasmin in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, rat samples\n66156-1-Ig targets Ceruloplasmin in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: human placenta tissue, rat liver tissue,  HSC-T6 cells,  human kidney tissue,  human blood tissue\nPositive IHC detected in: human ovary tumor tissue, human placenta tissue,  human liver tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:20-1:200\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCeruloplasmin (CP) is a serum glycoprotein synthesized by hepatocytes and functions as the major transport protein of copper in blood where it acts as ferrodoxidase and is required for iron transport of transferrin. The intact ceruloplasmin migrated around 130-140 kDa and some proteolytic cleaved fragments could also be observed.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag15535 Product name: Recombinant human CP protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 194-446 aa of BC146663 Sequence: IGPLIICKKDSLDKEKEKHIDREFVVMFSVVDENFSWYLEDNIKTYCSEPEKVDKDNEDFQESNRMYSVNGYTFGSLPGLSMCAEDRVKWYLFGMGNEVDVHAAFFHGQALTNKNYRIDTINLFPATLFDAYMVAQNPGEWMLSCQNLNHLKAGLQAFFQVQECNKSSSKDNIRGKHVRHYYIAAEEIIWNYAPSGIDIFTKENLTAPGSDSAVFFEQGTTRIGGSYKKLVYREYTDASFTNRKERGPEEEHL Predict reactive species\nFull Name: ceruloplasmin (ferroxidase)\nCalculated Molecular Weight: 1065 aa, 122 kDa\nObserved Molecular Weight: 140 kDa\nGenBank Accession Number: BC146663\nGene Symbol: Ceruloplasmin\nGene ID (NCBI): 1356\nRRID: AB_2881552\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P00450\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888002584745,"sku":"66156-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66156-1-ig","provider":"Iright","version":"1.0","type":"link"}