{"product_id":"proteintech-66161-1-ig","title":"Proteintech, 66161-1-Ig, BMI1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe BMI1 (66161-1-Ig) by Proteintech is a Monoclonal antibody targeting BMI1 in WB, IHC, IF\/ICC, IP, ELISA applications with reactivity to human, mouse, monkey samples\n66161-1-Ig targets BMI1 in WB, IHC, IF\/ICC, IP, ELISA applications and shows reactivity with human, mouse, monkey samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: PC-12 cells, HT-1080 cells,  U2OS cells,  U-937 cells\nPositive IP detected in: HEK-293 cells\nPositive IHC detected in: human breast cancer tissue, human colon  cancer,  human lymphoma tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells, COS-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nBMI- 1 is one of polycomb group genes, which together with Ring1 strongly enhances the E3 ubiquitin ligase activity of the Ring2 catalytic subunit. Bmi1 plays an important role in the regulation of cell proliferation and senescence through repression of the p16Ink4a and p19Arf genes and is required for maintenance of adult hematopoietic and neural stem cells. The antibody reacts with the 37kd BMI1 protein.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, monkey\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag21284 Product name: Recombinant human BMI1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-326 aa of BC011652 Sequence: MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICDVQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRGEVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHLRKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRMKISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGTSNSPSGNHQSSFANRPRKSSVNGSSATSSG Predict reactive species\nFull Name: BMI1 polycomb ring finger oncogene\nCalculated Molecular Weight: 37 kDa\nObserved Molecular Weight: 37-43 kDa\nGenBank Accession Number: BC011652\nGene Symbol: BMI1\nGene ID (NCBI): 648\nRRID: AB_2881557\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P35226\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887990001833,"sku":"66161-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66161-1-ig","provider":"Iright","version":"1.0","type":"link"}