{"product_id":"proteintech-66162-1-ig","title":"Proteintech, 66162-1-Ig, IFN Alpha Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IFN Alpha (66162-1-Ig) by Proteintech is a Monoclonal antibody targeting IFN Alpha in WB, ELISA applications with reactivity to human samples\n66162-1-Ig targets IFN Alpha in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Recombinant protein, Transfected HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nIFNA1 (IF-alpha) is a member of the Type I IFN (1) family best known for their antiviral activity. It is a key cytokine regulating the activity of B cells, T-helper cells (Th cells), cDCs and natural killer cells (NK cells). IFNA1 induces B cell maturation into plasma cells and immunoglobulin production. IFNA1 plays an important role in the pathogenesis of systemic lupus erythematosus (SLE). IFNA1 was the first cytokine to show clinical benefit in the treatment of certain types of cancer, including melanoma, chronic myelogenous leukemia, and renal cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag12533 Product name: Recombinant human IFNA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 24-189 aa of BC074928 Sequence: CDLPETHSLDNRRTLMLLAQMSRISPSSCLMDRHDFGFPQEEFDGNQFQKAPAISVLHELIQQIFNLFTTKDSSAAWDEDLLDKFCTELYQQLNDLEACVMQEERVGETPLMNADSILAVKKYFRRITLYLTEKKYSPCAWEVVRAEIMRSLSLSTNLQERLRRKE Predict reactive species\nFull Name: IFNA1\nCalculated Molecular Weight: 189 aa, 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC074928\nGene Symbol: IFN alpha1\nGene ID (NCBI): 3439\nRRID: AB_2881558\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P01562\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888029454505,"sku":"66162-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66162-1-ig","provider":"Iright","version":"1.0","type":"link"}