{"product_id":"proteintech-66163-1-ig","title":"Proteintech, 66163-1-Ig, IL-29 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-29 (66163-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-29 in WB, ELISA applications with reactivity to human samples\n66163-1-Ig targets IL-29 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Recombinant protein\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-29 (IL-29) is a cytokine belonging to the Type III interferon family, which has another two subfamilies IL-28A and IL-28B. They are also known as IFN-λ1, IFN-λ2 and IFN-λ3, respectively. IL-29 is produced predominantly by maturing dendritic cells and macrophages.  IL-29 plays an important role in the immune response against pathogenes and especially against viruses by mechanisms similar to type I interferons. IL-29 receptor signals through JAK-STAT pathways leading to activated expression of interferon-stimulated genes and production of antiviral proteins.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag12444 Product name: Recombinant human IL-29 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 24-200 aa of BC074985 Sequence: TSKPTTTGKGCHIGRFKSLSPQELASFKKARDALEESLKLKNWSCSSPVFPGNWDLRLLQVRERPVALEAELALTLKVLEAAAGPALEDVLDQPLHTLHHILSQLQACIQPQPTAGPRPRGRLHHWLHRLQEAPKKESAGCLEASVTFNLFRLLTRDLKYVADGNLCLRTSTHPEST Predict reactive species\nFull Name: interleukin 29 (interferon, lambda 1)\nCalculated Molecular Weight: 200 aa, 22 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC074985\nGene Symbol: IL-29\nGene ID (NCBI): 282618\nRRID: AB_2881559\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8IU54\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888286552233,"sku":"66163-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66163-1-ig","provider":"Iright","version":"1.0","type":"link"}