{"product_id":"proteintech-66188-1-ig","title":"Proteintech, 66188-1-Ig, Septin 8 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Septin 8 (66188-1-Ig) by Proteintech is a Monoclonal antibody targeting Septin 8 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n66188-1-Ig targets Septin 8 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells\nPositive IHC detected in: mouse brain tissue, human gliomas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSeptin 8, also named as KIAA0202, is a member of the highly conserved septin family. Septins are membrane-associated GTPases which are involved in cytokinesis and cellular morphogenesis. Septin 8 is an interaction partner of Septin 4. It may play a role in platelet secretion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgM\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag19114 Product name: Recombinant human SEPT8 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-256 aa of BC001329 Sequence: MKKLDSKVNIIPIIAKADTISKSELHKFKIKIMGELVSNGVQIYQFPTDDEAVAEINAVMNAHLPFAVVGSTEEVKVGNKLVRARQYPWGVVQVENENHCDFVKLREMLIRVNMEDLREQTHSRHYELYRRCKLEEMGFQDSDGDSQPFSLQETYEAKRKEFLSELQRKEEEMRQMFVNKVKETELELKEKERELHEKFEHLKRVHQEEKRKVEEKRRELEEETNAFNRRKAAVEALQSQALHATSQQPLRKDKDK Predict reactive species\nFull Name: septin 8\nCalculated Molecular Weight: 55.6 kDa\nObserved Molecular Weight: 50-58 kDa\nGenBank Accession Number: BC001329\nGene Symbol: Septin 8\nGene ID (NCBI): 23176\nRRID: AB_2881583\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Thiophilic affinity chromatograph\nUNIPROT ID: Q92599\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888322465961,"sku":"66188-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66188-1-ig","provider":"Iright","version":"1.0","type":"link"}