{"product_id":"proteintech-66190-1-ig","title":"Proteintech, 66190-1-Ig, IL-22RA2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-22RA2 (66190-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-22RA2 in WB, IHC, IF-P, ELISA applications with reactivity to human samples\n66190-1-Ig targets IL-22RA2 in WB, IHC, IF-P, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Raji cells\nPositive IHC detected in: mouse kidney tissue, human breast cancer tissue,  human lung cancer tissue,  human small intestine tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human breast cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:500-1:2000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-22 receptor subunit alpha-2 (IL22RA2) is a soluble member of the type II cytokine receptor family. Through binding to IL22, IL22RA2 prevents the interaction of IL22 with the functional IL22-R complex and blocks the activity of IL22 (in vitro). IL22RA2 may play an important role as an IL22 antagonist in the regulation of inflammatory responses. Alternative splicing results in multiple transcript variants encoding distinct isoforms.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, pig\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18682 Product name: Recombinant human IL-22RA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-232 aa of BC125167 Sequence: MMPKHCFLGFLISFFLTGVAGTQSTHESLKPQRVQFQSRNFHNILQWQPGRALTGNSSVYFVQYKIYGQRQWKNKEDCWGTQELSCDLTSETSDIQEPYYGRVRAASAGSYSEWSMTPRFTPWWETKIDPPVMNITQVNGSLLVILHAPNLPYRYQKEKNVSIEDYYELLYRVFIINNSLEKEQKVYEGAHRAVEIEALTPHSSYCVVAEIYQPMLDRRSQRSEERCVEIP Predict reactive species\nFull Name: interleukin 22 receptor, alpha 2\nCalculated Molecular Weight: 263 aa, 31 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC125167\nGene Symbol: IL-22RA2\nGene ID (NCBI): 116379\nRRID: AB_2881585\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q969J5\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888021033129,"sku":"66190-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66190-1-ig","provider":"Iright","version":"1.0","type":"link"}