{"product_id":"proteintech-66221-1-ig","title":"Proteintech, 66221-1-Ig, Alpha E-Catenin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Alpha E-Catenin (66221-1-Ig) by Proteintech is a Monoclonal antibody targeting Alpha E-Catenin in WB, IHC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n66221-1-Ig targets Alpha E-Catenin in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells\nPositive IHC detected in: human stomach tissue,  human colon tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive FC (Intra) detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:1000\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAlpha catenin is an essential component of adherens junctions that connects E-cadherin-β-catenin complexes with the actin cytoskeleton. It also recruits a range of other important proteins to developing intercellular junctions. Three alpha catenins exist in human: alpha-E-catenin, alpha-N-catenin, and alpha-T-catenin, which share substantial amino-acid sequence similarity but have distinct tissue distribution. alpha-E-catenin is ubiquitously expressed, alpha-N-catenin is restricted to neuronal tissue, and alpha-T-catenin is primarily expressed in heart tissue. Reduced levels of alpha-E-catenin protein seem to be characteristic of many different human cancers, including malignant tumours of the breast, colon, stomach, oesophagus, bladder and liver. In addition, the loss of alpha-E-catenin often correlates with the degree of tumour differentiation and metastasis.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag23603 Product name: Recombinant human CTNNA1 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 188-536 aa of BC031262 Sequence: SEMDNYEPGVYTEKVLEATKLLSNTVMPRFTEQVEAAVEALSSDPAQPMDENEFIDASRLVYDGIRDIRKAVLMIRTPEELDDSDFETEDFDVRSRTSVQTEDDQLIAGQSARAIMAQLPQEQKAKIAEQVASFQEEKSKLDAEVSKWDDSGNDIIVLAKQMCMIMMEMTDFTRGKGPLKNTSDVISAAKKIAEAGSRMDKLGRTIADHCPDSACKQDLLAYLQRIALYCHQLNICSKVKAEVQNLGGELVVSGVDSAMSLIQAAKNLMNAVVQTVKASYVASTKYQKSQGMASLNLPAVSWKMKAPEKKPLVKREKQDETQTKIKRASQKKHVNPVQALSEFKAMDSI Predict reactive species\nFull Name: catenin (cadherin-associated protein), alpha 1, 102kDa\nCalculated Molecular Weight: 906 aa, 100 kDa\nObserved Molecular Weight: 95-100 kDa\nGenBank Accession Number: BC031262\nGene Symbol: Alpha E-Catenin\nGene ID (NCBI): 1495\nRRID: AB_2881612\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P35221\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888017920169,"sku":"66221-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66221-1-ig","provider":"Iright","version":"1.0","type":"link"}