{"product_id":"proteintech-66244-1-ig","title":"Proteintech, 66244-1-Ig, CNN2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CNN2 (66244-1-Ig) by Proteintech is a Monoclonal antibody targeting CNN2 in WB, IHC, ELISA applications with reactivity to human, pig samples\n66244-1-Ig targets CNN2 in WB, IHC, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, A431 cells,  HeLa cells,  pig stomach tissue,  HT-1080 cells,  Jurkat cells,  K-562 cells\nPositive IHC detected in: human breast hyperplasia tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:500-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCalponin is a family of actin filament-associated proteins which regulate smooth muscle cell contraction. Three isoforms of calponin exist: calponin h1 (CNN1) , calponin h2 (CNN2) and calponin 3 (CNN3). Calponin 1 and calponin 2 are predominately expressed in smooth muscle cells and cardiac muscle cells, respectively. Calponin 3 is highly expressed in many tissues including articular cartilage and brain.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag23594 Product name: Recombinant human CNN2 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 224-309 aa of BC141818 Sequence: PGTRRHIYDTKLGTDKCDNSSMSLQMGYTQGANQSGQVFGLGRQIYDPKYCPQGTVADGAPSGTGDCPDPGEVPEYPPYYQEEAGY Predict reactive species\nFull Name: calponin 2\nCalculated Molecular Weight: 309 aa, 34 kDa\nObserved Molecular Weight: 34-36 kDa\nGenBank Accession Number: BC141818\nGene Symbol: CNN2\nGene ID (NCBI): 1265\nRRID: AB_2881633\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q99439\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888110162089,"sku":"66244-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66244-1-ig","provider":"Iright","version":"1.0","type":"link"}