{"product_id":"proteintech-66251-1-ig","title":"Proteintech, 66251-1-Ig, 14-3-3 Sigma Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe 14-3-3 Sigma (66251-1-Ig) by Proteintech is a Monoclonal antibody targeting 14-3-3 Sigma in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n66251-1-Ig targets 14-3-3 Sigma in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A-253 cells, A431 cells,  HeLa cells,  MCF-7 cells,  HT-1376 cells,  HaCaT cells,  SCaBER cells,  MCF-10A cells,  MDA-MB-468 cells\nPositive IHC detected in: human skin tissue, human breast cancer tissue,  human breast hyperplasia tissue,  human lung cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: MCF-7 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:200-1:8000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\n14-3-3 Sigma is a member 14-3-3 family of highly conserved proteins participating in diverse cellular processes including cell cycle progression. It is exclusively present in various epithelial cells, and alternatively named as human epithelial marker (HEM), or stratifin. Alteration of its expression has been linked to cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag12644 Product name: Recombinant human SFN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-248 aa of BC002995 Sequence: MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWTADNAGEEGGEAPQEPQS Predict reactive species\nFull Name: stratifin\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28-30 kDa\nGenBank Accession Number: BC002995\nGene Symbol: 14-3-3 Sigma\nGene ID (NCBI): 2810\nRRID: AB_2881639\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P31947\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888017625257,"sku":"66251-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66251-1-ig","provider":"Iright","version":"1.0","type":"link"}