{"product_id":"proteintech-66323-1-ig","title":"Proteintech, 66323-1-Ig, Glutamine Synthetase Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Glutamine Synthetase (66323-1-Ig) by Proteintech is a Monoclonal antibody targeting Glutamine Synthetase in WB, IHC, IF, ELISA applications with reactivity to human,  pig, zebrafish samples\n66323-1-Ig targets Glutamine Synthetase in WB, IHC, IF, ELISA applications and shows reactivity with human,  pig, zebrafish samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, pig liver tissue,  pig brain tissue\nPositive IHC detected in: human liver cancer tissue, human brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF detected in: zebrafish retina, human brain tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF): IF : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nGLUL(Glutamine synthetase) is also named as GS,GLNS and belongs to the glutamine synthetase family.This enzyme has 2 functions: it catalyzes the production of glutamine and 4-aminobutanoate (gamma-aminobutyric acid, GABA), the latter in a pyridoxal phosphate-independent manner By similarity. Essential for proliferation of fetal skin fibroblasts (PMID:18662667).Defects in GLUL are the cause of congenital systemic glutamine deficiency (CSGD).Organismal glutamine production is augmented secondary to an increase in the activity of glutamine synthetase in the lung and skeletal muscle(PMID:7630137). There are other bands with higher (66 kDa, 97 kDa) and lower (30 kDa)molecular weights also detected besides the 42 kDa band indicating the proteolysis of GLUL protein by the ubiquitin system(PMID:10091759).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig, zebrafish\nCited Reactivity: human, mouse, rat, zebrafish\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6309 Product name: Recombinant human Glutamine synthetase protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-373 aa of BC011700 Sequence: MTTSASSHLNKGIKQVYMSLPQGEKVQAMYIWIDGTGEGLRCKTRTLDSEPKCVEELPEWNFDGSSTLQSEGSNSDMYLVPAAMFRDPFRKDPNKLVLCEVFKYNRRPAETNLRHTCKRIMDMVSNQHPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHYRACLYAGVKIAGTNAEVMPAQWEFQIGPCEGISMGDHLWVARFILHRVCEDFGVIATFDPKPIPGNWNGAGCHTNFSTKAMREENGLKYIEEAIEKLSKRHQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQEKKGYFEDRRPSANCDPFSVTEALIRTCLLNETGDEPFQYKN Predict reactive species\nFull Name: glutamate-ammonia ligase (glutamine synthetase)\nCalculated Molecular Weight: 374 aa, 42 kDa\nObserved Molecular Weight: 42 kDa\nGenBank Accession Number: BC011700\nGene Symbol: Glutamine Synthetase\nGene ID (NCBI): 2752\nRRID: AB_2881703\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P15104\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887998324905,"sku":"66323-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66323-1-ig","provider":"Iright","version":"1.0","type":"link"}