{"product_id":"proteintech-66339-1-ig","title":"Proteintech, 66339-1-Ig, RAB5A Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAB5A (66339-1-Ig) by Proteintech is a Monoclonal antibody targeting RAB5A in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, pig samples\n66339-1-Ig targets RAB5A in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells,  fetal human brain tissue,  pig brain tissue\nPositive IHC detected in: human liver cancer tissue,  human pancreas tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells, HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRab5a belongs to the Rab GTPases family proteins, which play roles in endocytosis, exocytosis, and vesicular transportation. Rab family proteins were recently reported to play important roles in human cancer progression. Rab5a was reported to be overexpressed in breast and ovarian cancers and associated with proliferation and invasion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig\nCited Reactivity: human, mouse, monkey\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16781 Product name: Recombinant human RAB5A protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-215 aa of BC001267 Sequence: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN Predict reactive species\nFull Name: RAB5A, member RAS oncogene family\nCalculated Molecular Weight: 215 aa, 24 kDa\nObserved Molecular Weight: 24 kDa\nGenBank Accession Number: BC001267\nGene Symbol: RAB5A\nGene ID (NCBI): 5868\nRRID: AB_2881719\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P20339\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888004583593,"sku":"66339-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66339-1-ig","provider":"Iright","version":"1.0","type":"link"}