{"product_id":"proteintech-66367-1-ig","title":"Proteintech, 66367-1-Ig, SKAP2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SKAP2 (66367-1-Ig) by Proteintech is a Monoclonal antibody targeting SKAP2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human,  pig,  rat,  mouse samples\n66367-1-Ig targets SKAP2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human,  pig,  rat,  mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: RAW 264.7 cells,  human spleen tissue,  pig liver tissue\nPositive IHC detected in: human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nSKAP2 (src kinase associated phosphoprotein 2), also named PRAP, contains PH domain and SH3 domain. It is localized in cytoplasm and was expressed in ubiquitously in various tissues including lung, skeletal muscle, and spleen, but not detectable in thymus and T cell lymphoma cells. SKAP2 may negatively regulate alpha-synuclein phosphorylation following cell stress. SKAP2 may be involved in B-cell and macrophage adhesion processes by coupling the B-cell receptor (BCR) to integrin activation.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, pig, rat, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag3615 Product name: Recombinant human SKAP2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-359 aa of BC036044 Sequence: MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDI Predict reactive species\nFull Name: src kinase associated phosphoprotein 2\nCalculated Molecular Weight: 41 kDa\nObserved Molecular Weight: 55 kDa\nGenBank Accession Number: BC036044\nGene Symbol: SKAP2\nGene ID (NCBI): 8935\nRRID: AB_2881747\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O75563\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888324104361,"sku":"66367-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66367-1-ig","provider":"Iright","version":"1.0","type":"link"}