{"product_id":"proteintech-66402-1-ig","title":"Proteintech, 66402-1-Ig, TPRKB Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TPRKB (66402-1-Ig) by Proteintech is a Monoclonal antibody targeting TPRKB in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n66402-1-Ig targets TPRKB in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  COLO 320 cells,  Caco-2 cells,  Jurkat cells,  Raji cells\nPositive IHC detected in: human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:4000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTPRKB, also named as CGI 121, belongs to the CGI121\/TPRKB family. It interacts with TP53RK\/PRPK and is widely expressed in all tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18770 Product name: Recombinant human TPRKB protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-175 aa of BC029492 Sequence: MQLTHQLDLFPECRVTLLLFKDVKNAGDLRRKAMEGTIDGSLINPTVIVDPFQILVAANKAVHLYKLGKMKTRTLSTEIIFNLSPNNNISEALKKFGISANDTSILIVYIEEGEKQINQEYLISQVEGHQVSLKNLPEIMNITEVKKIYKLSSQEESIGTLLDAIICRMSTKDVL Predict reactive species\nFull Name: TP53RK binding protein\nCalculated Molecular Weight: 175 aa, 20 kDa\nObserved Molecular Weight: 18-20 kDa\nGenBank Accession Number: BC029492\nGene Symbol: TPRKB\nGene ID (NCBI): 51002\nRRID: AB_2881776\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9Y3C4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888332427433,"sku":"66402-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66402-1-ig","provider":"Iright","version":"1.0","type":"link"}