{"product_id":"proteintech-66416-1-ig","title":"Proteintech, 66416-1-Ig, P2RX4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe P2RX4 (66416-1-Ig) by Proteintech is a Monoclonal antibody targeting P2RX4 in WB, IHC, ELISA applications with reactivity to human,  mouse,  pig,  rat samples\n66416-1-Ig targets P2RX4 in WB, IHC, ELISA applications and shows reactivity with human,  mouse,  pig,  rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  mouse brain tissue,  rat brain tissue,  rabbit brain tissue,  Neuro-2a cells,  human brain tissue,  pig brain tissue\nPositive IHC detected in: human kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:8000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNucleotides, the structural subunits of the nucleic acids, are also important extracellular signaling molecules. P2 receptors are a family of cell surface receptors that mediate a wide variety of physiologic effects in response to extracellular nucleotides. These receptors fall into two classes: P2X receptors, which are ligand-gated ion channels that mediate calcium and potassium fluxes in response to ATP, and P2Y receptors, which are G protein-coupled receptors (GPCRs). P2RX4 (P2X purinoceptor 4) is a receptor for ATP acting as a ligand gated ion channel. The calculated molecular weight of P2RX4 is 43 kDa, larger apparent molecular weights of 50-80 kDa have been reported, possibly due to post-translational glycosylation (PMID: 24040145, 15262999; 29382907; 12566439).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, pig, rat\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag4445 Product name: Recombinant human P2RX4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 57-341 aa of BC033826 Sequence: TDSVVSSVTTKVKGVAVTNTSKLGFRIWDVADYVIPAQEENSLFVMTNVILTMNQTQGLCPEIPDATTVCKSDASCTAGSAGTHSNGVSTGRCVAFNGSVKTCEVAAWCPVEDDTHVPQPAFLKAAENFTLLVKNNIWYPKFNFSKRNILPNITTTYLKSCIYDAKTDPFCPIFRLGKIVENAGHGFQDMAVEGGIMGIQVNWDCNLDRAASLCLPRYSFRRLDTRDVEHNVSPGYNFRFAKYYRDLAGNEQRTLIKAYGIRFDIIVFGKAGKFDIIPTMINIGS Predict reactive species\nFull Name: purinergic receptor P2X, ligand-gated ion channel, 4\nCalculated Molecular Weight: 388 aa, 43 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC033826\nGene Symbol: P2RX4\nGene ID (NCBI): 5025\nRRID: AB_2881788\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q99571\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888047149225,"sku":"66416-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66416-1-ig","provider":"Iright","version":"1.0","type":"link"}