{"product_id":"proteintech-66433-1-ig","title":"Proteintech, 66433-1-Ig, Amphiregulin Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Amphiregulin (66433-1-Ig) by Proteintech is a Monoclonal antibody targeting Amphiregulin in WB, IHC, ELISA applications with reactivity to human, rat, pig samples\n66433-1-Ig targets Amphiregulin in WB, IHC, IF, ELISA applications and shows reactivity with human, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A549 cells, rat brain tissue,  MCF-7 cells,  pig brain tissue\nPositive IHC detected in: human pancreas cancer tissue,  human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAmphiregulin (AREG) is one of the ligands of the epidermal growth factor receptor (EGFR). AREG plays a central role in mammary gland development and branching morphogenesis in organs and is expressed both in physiological and in cancerous tissues. The AREG protein is synthesized as a 252-amino acid transmembrane precursor, pro-AREG. At the plasma membrane, pro-AREG is subjected to sequential proteolytic cleavages within its ectodomain and is then released as the soluble AREG protein. Depending on the cell type and microenvironment, AREG can be produced in multiple cellular and mature forms using alternative pro-AREG cleavage sites and glycosylation motifs. Post-translastional modfications of 50-kDa pro-AREG produces a major soluble 43-kDa form, 28-, 26-, 16-kDa membrane anchored forms, and soluble 21-, 19-, and 9-kDa forms (PMID: 9642297).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag8907 Product name: Recombinant human AREG protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 25-252 aa of BC009799 Sequence: AGLDLNDTYSGKREPFSGDHSADGFEVTSRSEMSSGSEISPVSEMPSSSEPSSGADYDYSEEYDNEPQIPGYIVDDSVRVEQVVKPPQNKTESENTSDKPKRKKKGGKNGKNRRNRKKKNPCNAEFQNFCIHGECKYIEHLEAVTCKCQQEYFGERCGEKSMKTHSMIDSSLSKIALAAIAAFMSAVILTAVAVITVQLRRQYVRKYEGEAEERKKLRQENGNVHAIA Predict reactive species\nFull Name: amphiregulin\nCalculated Molecular Weight: 252 aa, 28 kDa\nObserved Molecular Weight: 50 kDa, 37 kDa\nGenBank Accession Number: BC009799\nGene Symbol: Amphiregulin\/AREG\nGene ID (NCBI): 374\nRRID: AB_2881803\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P15514\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888002322601,"sku":"66433-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66433-1-ig","provider":"Iright","version":"1.0","type":"link"}