{"product_id":"proteintech-66441-1-ig","title":"Proteintech, 66441-1-Ig, RGS4 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RGS4 (66441-1-Ig) by Proteintech is a Monoclonal antibody targeting RGS4 in WB, ELISA applications with reactivity to human,  rat,  mouse,  pig samples\n66441-1-Ig targets RGS4 in WB, IHC, ELISA applications and shows reactivity with human,  rat,  mouse,  pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Neuro-2a cells,  C6 cells,  Raji cells,  SH-SY5Y cells,  U-251 cells,  Y79 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:12000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRegulator of G protein signaling (RGS) proteins are a large family of highly diverse, multifunctional signaling proteins. RGS4 is one of seven members of a classic R4 RGS protein that accelerates the GTPase activity of the Gai\/o and Gaq\/11 family members. RGS4 is highly expressed in multiple brain regions including the cerebral cortex, amygdala, hippocampus, and striatum. Extensive studies have demonstrated that RGS4 plays an important role in regulating smooth muscle contraction, cardiomyocyte development, neural plasticity and psychiatric disorders.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat, mouse, pig\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag6029 Product name: Recombinant human RGS4 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-205 aa of BC051869 Sequence: MCKGLAGLPASCLRSAKDMKHRLGFLLQKSDSCEHNSSHNKKDKVVICQRVSQEEVKKWAESLENLISHECGLAAFKAFLKSEYSEENIDFWISCEEYKKIKSPSKLSPKAKKIYNEFISVQATKEVNLDSCTREETSRNMLEPTITCFDEAQKKIFNLMEKDSYRRFLKSRFYLDLVNPSSCGAEKQKGAKSSADCASLVPQCA Predict reactive species\nFull Name: regulator of G-protein signaling 4\nCalculated Molecular Weight: 23 kDa\nObserved Molecular Weight: 34 kDa\nGenBank Accession Number: BC051869\nGene Symbol: RGS4\nGene ID (NCBI): 5999\nRRID: AB_2881811\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P49798\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888049049769,"sku":"66441-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66441-1-ig","provider":"Iright","version":"1.0","type":"link"}