{"product_id":"proteintech-66470-2-ig","title":"Proteintech, 66470-2-Ig, Caspase 3\/P17\/P19 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Caspase 3\/P17\/P19 (66470-2-Ig) by Proteintech is a Monoclonal antibody targeting Caspase 3\/P17\/P19 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n66470-2-Ig targets Caspase 3\/P17\/P19 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HEK-293 cells,  NIH\/3T3 cells,  HepG2 cells,  HeLa cells\nPositive IHC detected in: human breast cancer tissue, mouse liver tissue,  mouse kidney tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:3000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCaspases, a family of endoproteases, are critical players in cell regulatory networks controlling inflammation and cell death. Initiator caspases (caspase-2, -8, -9, -10, -11, and -12) cleave and activate downstream effector caspases (caspase-3, -6, and -7), which in turn execute apoptosis by cleaving targeted cellular proteins. Caspase 3 (also named CPP32, SCA-1, and Apopain) proteolytically cleaves poly(ADP-ribose) polymerase (PARP) at the beginning of apoptosis. Caspase 3 plays a key role in the activation of sterol regulatory element binding proteins (SREBPs) between the basic helix-loop-helix leucine zipper domain and the membrane attachment domain. Caspase 3 can also form heterocomplex with other proteins and performs the molecular mass of 50-70 kDa. This antibody can recognize p17, p19 and p32 of Caspase 3.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse, rat, pig, canine, chicken, plant\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25029 Product name: Recombinant human CASP3 protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 31-176 aa of BC016926 Sequence: ISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIETDS Predict reactive species\nFull Name: caspase 3, apoptosis-related cysteine peptidase\nCalculated Molecular Weight: 277 aa, 32 kDa\nObserved Molecular Weight: 32-35 kDa, 19 kDa, 17 kDa\nGenBank Accession Number: BC016926\nGene Symbol: Caspase 3\nGene ID (NCBI): 836\nRRID: AB_2876892\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P42574\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887968440489,"sku":"66470-2-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66470-2-ig","provider":"Iright","version":"1.0","type":"link"}