{"product_id":"proteintech-66494-1-ig","title":"Proteintech, 66494-1-Ig, NR2E3 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe NR2E3 (66494-1-Ig) by Proteintech is a Monoclonal antibody targeting NR2E3 in WB, ELISA applications with reactivity to Pig, Mouse samples\n66494-1-Ig targets NR2E3 in WB, ELISA applications and shows reactivity with Pig, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig retina tissue, mouse retina tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nNR2E3, also known as PNR, encodes a retinal nuclear receptor that is a ligand-dependent transcription factor. This protein is part of a large family of nuclear receptor transcription factors involved in signaling pathways. NR2E3 influences the development of photoreceptors and their differentiation into rod and cone types, and acts as a ranscriptional factor that is an activator of rod development and repressor of cone development [PMID:20725840]. It binds the promoter region of a number of rod- and cone-specific genes, including rhodopsin, M- and S-opsin and rod-specific phosphodiesterase beta subunit. [PMID:15689355]\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Pig, Mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag5831 Product name: Recombinant human NR2E3 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-322 aa of BC041421 Sequence: MCPVDKAHRNQCQACRLKKCLQAGMNQDAVQNERQPRSTAQVHLDSMESNTESRPESLVAPPAPAGRSPRGPTPMSAARALGHHFMASLITAETCAKLEPEDADENIDVTSNDPEFPSSPYSSSSPCGLDSIHETSARLLFMAVKWAKNLPVFSSLPFRDQVILLEEAWSELFLLGAIQWSLPLDSCPLLAPPEASAAGGAQGRLTLASMETRVLQETISRFRALAVDPTEFACMKALVLFKPETRGLKDPEHVEALQDQSQVMLSQHSKAHHPSQPVRFGKLLLLLPSLRFITAERIELLFFRKTIGNTPMEKLLCDMFKN Predict reactive species\nFull Name: nuclear receptor subfamily 2, group E, member 3\nCalculated Molecular Weight: 45 kDa\nObserved Molecular Weight: 45-50 kDa\nGenBank Accession Number: BC041421\nGene Symbol: NR2E3\nGene ID (NCBI): 10002\nRRID: AB_2881859\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9Y5X4\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888306540713,"sku":"66494-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66494-1-ig","provider":"Iright","version":"1.0","type":"link"}