{"product_id":"proteintech-66499-1-ig","title":"Proteintech, 66499-1-Ig, TAU Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TAU (66499-1-Ig) by Proteintech is a Monoclonal antibody targeting TAU in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples\n66499-1-Ig targets TAU in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Y79 cells,  pig brain tissue,  SH-SY5Y cells,  U-251 cells,  Neuro-2a cells,  rat brain tissue,  mouse brain tissue\nPositive IHC detected in: human gliomas tissue, mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:30000\nImmunohistochemistry (IHC): IHC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe microtubule-associated protein TAU (MAPT or TAU) is encoded by MAPT gene, which locates on human chromosome 17q21, binds to the tubulin subunit of microtubule and promotes its assembly and stability. Most TAU is expressed in neurons, and TAU isoform is expressed in the peripheral nervous system while the others are expressed in the central nervous system. TAU links axonal microtubules with C-terminus to neural plasma membrane components with its N-terminus, suggesting the participation in intracellular signal transduction and neuron's development and viability.  Various isoforms of Tau exist due to the alternative splicing, and short isoforms around 45-69 kDa and long isoforms around 100-110 kDa have been reported in different literature (PMID:8752131,15965697, 12485403).Present monoclonal anti-Tau antibody  can detect approx 100-kDa bands in brain tissues.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse, rat, rabbit\nHost \/ Isotype: Mouse \/ IgG2c\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag21926 Product name: Recombinant human TAU protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 5-208 aa of BC000558 Sequence: PRQEFEVMEDHAGTYGLGDRKDQGGYTMHQDQEGDTDAGLKAEEAGIGDTPSLEDEAAGHVTQARMVSKSKDGTGSDDKKAKGADGKTKIATPRGAAPPGQKGQANATRIPAKTPPAPKTPPSSGEPPKSGDRSGYSSPGSPGTPGSRSRTPSLPTPPTREPKKVAVVRTPPKSPSSAKSRLQTAPVPMPDLKNVKSKIGSTENL Predict reactive species\nFull Name: microtubule-associated protein tau\nCalculated Molecular Weight: 37-46, 79-81 kDa\nObserved Molecular Weight: 100 kDa\nGenBank Accession Number: BC000558\nGene Symbol: TAU\nGene ID (NCBI): 4137\nRRID: AB_2881863\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P10636\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887985119401,"sku":"66499-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66499-1-ig","provider":"Iright","version":"1.0","type":"link"}