{"product_id":"proteintech-66508-1-ig","title":"Proteintech, 66508-1-Ig, SP1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe SP1 (66508-1-Ig) by Proteintech is a Monoclonal antibody targeting SP1 in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications with reactivity to human, mouse, rat samples\n66508-1-Ig targets SP1 in WB, IHC, IF\/ICC, IF-P, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, NIH\/3T3 cells,  HEK-293 cells,  HeLa cells\nPositive IHC detected in: human lung cancer tissue, human colon cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human colon cancer tissue\nPositive IF\/ICC detected in: HEK-293 cells\nPositive FC (Intra) detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:175-1:700\nImmunofluorescence (IF)-P: IF-P : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe transcription factor Sp1 is a C2H2 zinc-finger protein that is involved in the regulation of a wide variety of genes, including housekeeping genes and tumor-developing genes. It is associated with tumor development, growth, and metastasis [PMID: 16209919]. It regulates the expression of a large number of genes involved in a variety of processes such as cell growth, apoptosis, differentiation and immune responses. Besides, it has a role in modulating the cellular response to DNA damage, recruiting SMARCA4\/BRG1 on the c-FOS promoter, regulation of FE65 gene expression [PMID:11371615,16332679]. SP1 has some isoforms with MW ~95-106 kDa and ~60 kDa [PMID:17462816].\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16720 Product name: Recombinant human SP1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 437-785 aa of BC062539 Sequence: NLQLQAVPNSGPIIIRTPTVGPNGQVSWQTLQLQNLQVQNPQAQTITLAPMQGVSLGQTSSSNTTLTPIASAASIPAGTVTVNAAQLSSMPGLQTINLSALGTSGIQVHPIQGLPLAIANAPGDHGAQLGLHGAGGDGIHDDTAGGEEGENSPDAQPQAGRRTRREACTCPYCKDSEGRGSGDPGKKKQHICHIQGCGKVYGKTSHLRAHLRWHTGERPFMCTWSYCGKRFTRSDELQRHKRTHTGEKKFACPECPKRFMRSDHLSKHIKTHQNKKGGPGVALSVGTLPLDSGAGSEGSGTATPSALITTNMVAMEAICPEGIARLANSGINVMQVADLQSINISGNGF Predict reactive species\nFull Name: Sp1 transcription factor\nCalculated Molecular Weight: 785 aa, 81 kDa\nObserved Molecular Weight: 95-105 kDa, 60-65 kDa\nGenBank Accession Number: BC062539\nGene Symbol: SP1\nGene ID (NCBI): 6667\nENSEMBL Gene ID: ENSG00000185591\nRRID: AB_2881871\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P08047\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888008220841,"sku":"66508-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66508-1-ig","provider":"Iright","version":"1.0","type":"link"}