{"product_id":"proteintech-66514-1-ig","title":"Proteintech, 66514-1-Ig, USP7 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe USP7 (66514-1-Ig) by Proteintech is a Monoclonal antibody targeting USP7 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, rat, mouse samples\n66514-1-Ig targets USP7 in WB, IHC, IF\/ICC, IP, CoIP, ELISA applications and shows reactivity with Human, rat, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, A549 cells,  LNCaP cells,  HEK-293 cells,  Jurkat cells,  HSC-T6 cells,  ROS1728 cells,  NIH\/3T3 cells,  HepG2 cells,  K-562 cells,  4T1 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:50-1:500\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat, mouse\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25652 Product name: Recombinant human USP7 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-93 aa of Sequence: MLLDNVENKMKGTCVEGTIPKLFRGKMVSYIQCKEVDYRSDRREDYYDIQLSIKGKKNIFESFVDYVAVEQLDGDNKYDAGEHGLQEAEKGVK Predict reactive species\nFull Name: ubiquitin specific peptidase 7 (herpes virus-associated)\nObserved Molecular Weight: 128 kDa\nGene Symbol: USP7\nGene ID (NCBI): 7874\nRRID: AB_2881877\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q93009\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887982989481,"sku":"66514-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66514-1-ig","provider":"Iright","version":"1.0","type":"link"}