{"product_id":"proteintech-66533-1-ig","title":"Proteintech, 66533-1-Ig, AP5Z1\/SPG48 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe AP5Z1\/SPG48 (66533-1-Ig) by Proteintech is a Monoclonal antibody targeting AP5Z1\/SPG48 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, rat samples\n66533-1-Ig targets AP5Z1\/SPG48 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: Jurkat cells, HL-60 cells,  Caco-2 cells,  COLO 320 cells,  HSC-T6 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:5000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nAP5Z1, also known as SPG48 and KIAA0415, is a part of AP-5. Biallelic mutations in the AP5Z1 gene encoding the AP5Z1 subunit have been described in a small number of patients with hereditary spastic paraplegia (HSP). AP5Z1 physically interacts with other HSP proteins and that patient cells are sensitive to DNA damaging drugs.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26961 Product name: Recombinant human KIAA0415 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 260-364 aa of BC037399 Sequence: TLDTDDRSEQEGSTLSVISATSSAGRLLPPRERLREVAFEYCQRLIEQSNRRALRKGDSDLQKACLVEAVLVLDVLCRQDPSFLYRSLSCLKALHGRVRGDPASV Predict reactive species\nFull Name: KIAA0415\nCalculated Molecular Weight: 807 aa, 88 kDa\nObserved Molecular Weight: 88 kDa\nGenBank Accession Number: BC037399\nGene Symbol: AP5Z1\/SPG48\nGene ID (NCBI): 9907\nRRID: AB_2881896\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O43299\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888099217577,"sku":"66533-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66533-1-ig","provider":"Iright","version":"1.0","type":"link"}