{"product_id":"proteintech-66536-1-ig","title":"Proteintech, 66536-1-Ig, AMPK Alpha 1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe AMPK Alpha 1 (66536-1-Ig) by Proteintech is a Monoclonal antibody targeting AMPK Alpha 1 in WB, IHC, ELISA applications with reactivity to Human, Rat, Mouse samples\n66536-1-Ig targets AMPK Alpha 1 in WB, IHC, IF, CoIP, ELISA applications and shows reactivity with Human, Rat, Mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, Jurkat cells,  HSC-T6 cells,  NIH\/3T3 cells,  HEK-293 cells,  A549 cells,  HepG2 cells,  K-562 cells,  PC-12 cells,  L02 cells,  HT-29 cells,  THP-1 cells,  4T1 cells,  MCF-7 cells\nPositive IHC detected in: human breast cancer tissue, human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\n\u003cb\u003eBackground Information\u003c\/b\u003e\nThe mammalian 5-prime-AMP-activated protein kinase (AMPK) appears to play a role in protecting cells from stresses that cause ATP depletion by switching off ATP-consuming biosynthetic pathways. PRKAA1 is also named as AMPK1, ACACA kinase, HMGCR kinase. It is a mammalian homologue of sucrose non-fermenting protein kinase (SNF-1), which belongs to a serine\/threonine protein kinase family. It has 2 isoforms with molecular mass of 63-66 kDa produced by alternative splicing.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, Rat, Mouse\nCited Reactivity: human, mouse, rat, pig, hamster, goat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag24744 Product name: Recombinant human AMPK alpha protein Source: e coli. -derived, PET30a Tag: 6*His Domain: 1-207 aa of BC012622 Sequence: MATAEKQKHDGRVKIGHYILGDTLGVGTFGKVKVGKHELTGHKVAVKILNRQKIRSLDVVGKIRREIQNLKLFRHPHIIKLYQVISTPSDIFMVMEYVSGGELFDYICKNGRLDEKESRRLFQQILSGVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRDCNIIRILTSQFTNYQH Predict reactive species\nFull Name: protein kinase, AMP-activated, alpha 1 catalytic subunit\nCalculated Molecular Weight: 63 kDa\nObserved Molecular Weight: 64 kDa\nGenBank Accession Number: BC012622\nGene Symbol: AMPK Alpha 1\nGene ID (NCBI): 5562\nRRID: AB_2881899\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q13131\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887975387305,"sku":"66536-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66536-1-ig","provider":"Iright","version":"1.0","type":"link"}