{"product_id":"proteintech-66539-1-ig","title":"Proteintech, 66539-1-Ig, RYR1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RYR1 (66539-1-Ig) by Proteintech is a Monoclonal antibody targeting RYR1 in IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n66539-1-Ig targets RYR1 in IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive IHC detected in: mouse skeletal muscle tissue, mouse cerebellum tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: A-673 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRyanodine receptor isoform-1 (RyR1) is a major calcium channel in skeletal muscle important for excitation-contraction coupling. The transmembrane region of RyR1 is comprised of two domains including the pseudo voltage sensor domain and the pore-forming domain (PMID: 27855725). Dominant RyR1 mutations are the leading cause of MH. Studies on the Ca2+ conducting properties of RyR1 channels containing Malignant hyperthermia mutations expressed in myotubes.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25120 Product name: Recombinant human RYR1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 4942-5038 aa of NM_000540 Sequence: GELRDQQEQVKEDMETKCFICGIGSDYFDTTPHGFETHTLEEHNLANYMFFLMYLINKDETEHTGQESYVWKMYQERCWDFFPAGDCFRKQYEDQLS Predict reactive species\nFull Name: ryanodine receptor 1 (skeletal)\nCalculated Molecular Weight: 565 kDa\nGenBank Accession Number: NM_000540\nGene Symbol: RYR1\nGene ID (NCBI): 6261\nRRID: AB_2881901\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P21817\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888074510505,"sku":"66539-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66539-1-ig","provider":"Iright","version":"1.0","type":"link"}