{"product_id":"proteintech-66544-1-ig","title":"Proteintech, 66544-1-Ig, TWIST2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe TWIST2 (66544-1-Ig) by Proteintech is a Monoclonal antibody targeting TWIST2 in WB, IHC, IF\/ICC, ELISA applications with reactivity to Human, rat, mouse, pig samples\n66544-1-Ig targets TWIST2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with Human, rat, mouse, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, THP-1 cells,  HL-60 cells,  Jurkat cells,  NIH\/3T3 cells,  K-562 cells,  HSC-T6 cells\nPositive IHC detected in: human breast cancer tissue, human ovary tumor tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:20000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nTWIST2, also named as BHLHA39 and DERMO1,is a basic helix-loop-helix protein which acts as a transcriptional regulator, plays a central role in differentiation of mesodermal during embryogenesis. TWIST2 inhibits the premature or ectopic differentiation of preosteoblast cells during osteogenesis, possibly by changing the internal signal transduction response of osteoblasts to external growth factors. It is also implicated in tumorigenesis, invasion and metastasis. TWIST2 forms both homodimers(45KD) and heterodimers with E2A E proteins, and dimer partner selection is a critical mediator of TWIST function. (PMID:14724576, 16502419).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, rat, mouse, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag2348 Product name: Recombinant human TWIST2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-160 aa of BC033168 Sequence: MEEGSSSPVSPVDSLGTSEEELERQPKRFGRKRRYSKKSSEDGSPTPGKRGKKGSPSAQSFEELQSQRILANVRERQRTQSLNEAFAALRKIIPTLPSDKLSKIQTLKLAARYIDFLYQVLQSDEMDNKMTSCSYVAHERLSYAFSVWRMEGAWSMSASH Predict reactive species\nFull Name: twist homolog 2 (Drosophila)\nCalculated Molecular Weight: 160 aa, 18 kDa\nObserved Molecular Weight: 22 kDa\nGenBank Accession Number: BC033168\nGene Symbol: TWIST2\nGene ID (NCBI): 117581\nRRID: AB_2881906\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q8WVJ9\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888017494185,"sku":"66544-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66544-1-ig","provider":"Iright","version":"1.0","type":"link"}