{"product_id":"proteintech-66558-1-ig","title":"Proteintech, 66558-1-Ig, PLDN Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PLDN (66558-1-Ig) by Proteintech is a Monoclonal antibody targeting PLDN in WB, ELISA applications with reactivity to human, mouse, rat samples\n66558-1-Ig targets PLDN in WB, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, MCF-7 cells,  HEK-293 cells,  Jurkat cells,  ROS1728 cells,  RAW 264.7 cells,  NIH\/3T3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:3000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPallidin, also named as PLDN and PA, is involved in the development of lysosome-related organelles, such as melanosomes and platelet-dense granules. It may play a role in intracellular vesicle trafficking, particularly in the vesicle-docking and fusion process. Pallidin interacts with syntaxin-12 which is a t-SNARE protein that mediates vesicle docking and fusion.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag18095 Product name: Recombinant human PLDN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-172 aa of BC004819 Sequence: MSVPGPSSPDGALTRPPYCLEAGEPTPGLSDTSPDEGLIEDLTIEDKAVEQLAEGLLSHYLPDLQRSKQALQELTQNQVVLLDTLEQEISKFKECHSMLDINALFAEAKHYHAKLVNIRKEMLMLHEKTSKLKKRALKLQQKRQKEELEREQQREKEFEREKQLTARPAKRM Predict reactive species\nFull Name: pallidin homolog (mouse)\nCalculated Molecular Weight: 23~24 kDa\nObserved Molecular Weight: 26 kDa\nGenBank Accession Number: BC004819\nGene Symbol: PLDN\nGene ID (NCBI): 26258\nRRID: AB_2881919\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q9UL45\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888311357609,"sku":"66558-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66558-1-ig","provider":"Iright","version":"1.0","type":"link"}