{"product_id":"proteintech-66567-1-ig","title":"Proteintech, 66567-1-Ig, CD151 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe CD151 (66567-1-Ig) by Proteintech is a Monoclonal antibody targeting CD151 in WB, IHC, IF-P, IP, ELISA applications with reactivity to human samples\n66567-1-Ig targets CD151 in WB, IHC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: unboiled A431 cells, 37°C incubated A549 cells,  unboiled human placenta tissue\nPositive IP detected in: human placenta tissue\nPositive IHC detected in: human tonsillitis tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human tonsillitis tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate\nImmunohistochemistry (IHC): IHC : 1:200-1:800\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nCD151 (also known as TSPAN24) is a membrane protein of the tetraspanin superfamily, which are characterized by the presence of four conserved transmembrane regions. Many of these members are involved in the regulation of cell development, activation, growth and motility. CD151 is broadly expressed by a variety of cell types. It is involved in cellular processes including cell adhesion and may regulate integrin trafficking and\/or function. CD151 enhances cell motility, invasion and metastasis of cancer cells.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25985 Product name: Recombinant human CD151 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 113-221 aa of BC001374 Sequence: AYYQQLNTELKENLKDTMTKRYHQPGHEAVTSAVDQLQQEFHCCGSNNSQDWRDSEWIRSQEAGGRVVPDSCCKTVVALCGQRDHASNIYKVEGGCITKLETFIQEHLR Predict reactive species\nFull Name: CD151 molecule (Raph blood group)\nCalculated Molecular Weight: 28 kDa\nObserved Molecular Weight: 28 kDa\nGenBank Accession Number: BC001374\nGene Symbol: CD151\nGene ID (NCBI): 977\nRRID: AB_2881928\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P48509\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888014545065,"sku":"66567-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66567-1-ig","provider":"Iright","version":"1.0","type":"link"}