{"product_id":"proteintech-66569-1-ig","title":"Proteintech, 66569-1-Ig, LATS1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe LATS1 (66569-1-Ig) by Proteintech is a Monoclonal antibody targeting LATS1 in WB, ELISA applications with reactivity to human samples\n66569-1-Ig targets LATS1 in WB, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: T-47D cells, HeLa cells,  HEK-293 cells,  HepG2 cells,  MCF-7 cells,  K-562 cells,  Jurkat cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nLATS1(Large tumor suppressor homolog 1) is also named as WARTS and belongds to the AGC Ser\/Thr protein kinase family. The gene encodes a highly conserved (from fly to human) protein kinase that plays a crucial role in the prevention of tumor formation by controlling the progression of mitosis. The expression of both long(170 kDa) and short lats1 isoforms(120 kDa) in vertebrate retinal cells raises the possibility that these lats1 proteins may act as negative key regulators of the cell cycle each of them performing a unique role (PMID:15777619). In mammalian cells, LATS1 was phosphorylated in a cell cycle-dependent manner and complexed with CDC2 in early mitosis (PMID:9988268). LATS1 also can be detected as 120 kDa and 140-150 kDa, and play a key role in the regulation of Hippo pathway (PMID: 27940445).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag11140 Product name: Recombinant human LATS1 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-135 aa of BC015665 Sequence: MKRSEKPEGYRQMRPKTFPASNYTVSSRQMLQEIRESLRNLSKPSDAAKAEHNMSKMSTEDPRQVRNPPKFGTHHKALQEIRNSLLPFANETNSSRSTSEVNPQMLQDLQAAGFDEEDHLSVACSPISLTKPFLI Predict reactive species\nFull Name: LATS, large tumor suppressor, homolog 1 (Drosophila)\nCalculated Molecular Weight: 15 kDa, 127 kDa\nObserved Molecular Weight: 140-150 kDa, 120 kDa\nGenBank Accession Number: BC015665\nGene Symbol: LATS1\nGene ID (NCBI): 9113\nRRID: AB_2881930\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q6PJG3\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888044167337,"sku":"66569-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66569-1-ig","provider":"Iright","version":"1.0","type":"link"}