{"product_id":"proteintech-66583-1-ig","title":"Proteintech, 66583-1-Ig, OPA1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe OPA1 (66583-1-Ig) by Proteintech is a Monoclonal antibody targeting OPA1 in WB, IHC, ELISA applications with reactivity to Human, mouse, pig, rat samples\n66583-1-Ig targets OPA1 in WB, IHC, IF, ELISA applications and shows reactivity with Human, mouse, pig, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HEK-293 cells, pig brain tissue,  HeLa cells,  HepG2 cells,  Y79 cells,  mouse brain tissue,  rat brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:500-1:2000\nImmunohistochemistry (IHC): IHC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nOPA1 is a nuclear-encoded mitochondrial protein with similarity to dynamin-related GTPases. OPA1 localizes to the inner mitochondrial membrane and helps regulate mitochondrial stability and energy output. This protein also sequesters cytochrome c. OPA1 is associated with the inner membrane and protects cells from apoptosis by regulating inner membrane dynamics. Mutation of OPA1 causes the disease dominant optic atrophy, a degeneration of the retinal ganglion cells. OPA1 undergoes complex posttranscriptional regulation and posttranslational proteolysis. OPA1 is regulated by proteolytic cleavage, which degrades long OPA1 isoforms into short isoforms. The gene OPA1 can be cleaved into some chains with MW 100 kDa and 80-90 kDa.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: Human, mouse, pig, rat\nCited Reactivity: human, mouse, rat, fish\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26868 Product name: Recombinant human OPA1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 650-780 aa of BC075805 Sequence: NTTVDIKLKQWTDKQLPNKAVEVAWETLQEEFSRFMTEPKGKEHDDIFDKLKEAVKEESIKRHKWNDFAEDSLRVIQHNALEDRSISDKQQWDAAIYFMEEALQARLKDTENAIENMVGPDWKKRWLYWKN Predict reactive species\nFull Name: optic atrophy 1 (autosomal dominant)\nCalculated Molecular Weight: 960 aa, 112 kDa\nObserved Molecular Weight: 100 kDa and 80-90 kDa\nGenBank Accession Number: BC075805\nGene Symbol: OPA1\nGene ID (NCBI): 4976\nRRID: AB_2881943\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O60313\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887985873065,"sku":"66583-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66583-1-ig","provider":"Iright","version":"1.0","type":"link"}