{"product_id":"proteintech-66592-1-ig","title":"Proteintech, 66592-1-Ig, RAF1 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe RAF1 (66592-1-Ig) by Proteintech is a Monoclonal antibody targeting RAF1 in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse samples\n66592-1-Ig targets RAF1 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, DC2.4 cells,  HEK-293 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HEK-293 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nRaf-1 proto-oncogene, serine\/threonine kinase(RAF1), is a MAP kinase kinase kinase (MAP3K), which functions downstream of the Ras family of membrane associated GTPases to which it binds directly. RAF1 has two isoforms with MW of 73, 75 kDa. RAF1 plays an important role in the control of gene expression involved in the cell division cycle, apoptosis, cell differentiation and cell migration.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25423 Product name: Recombinant human RAF1 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC018119 Sequence: MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIR Predict reactive species\nFull Name: v-raf-1 murine leukemia viral oncogene homolog 1\nCalculated Molecular Weight: 648 aa, 73 kDa\nObserved Molecular Weight: 70-75 kDa\nGenBank Accession Number: BC018119\nGene Symbol: RAF1\nGene ID (NCBI): 5894\nRRID: AB_2881952\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: P04049\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887989280937,"sku":"66592-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66592-1-ig","provider":"Iright","version":"1.0","type":"link"}