{"product_id":"proteintech-66605-1-ig","title":"Proteintech, 66605-1-Ig, ERMN Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ERMN (66605-1-Ig) by Proteintech is a Monoclonal antibody targeting ERMN in WB, IHC, ELISA applications with reactivity to human, mouse, rat, pig samples\n66605-1-Ig targets ERMN in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, pig cerebellum tissue,  rat brain tissue,  rat cerebellum tissue,  mouse brain tissue\nPositive IHC detected in: mouse brain tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:150-1:600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nERMN is associated with cytoskeletal rearrangements and the stability of myelin sheath. A study has shown that ERMN is expressed specifically in oligodendrocytes in the central nervous system (CNS), and is involved in the formation of myelin (PMID: 20934411). The predicted MW of ERMN is 33 KDa, while western blot analyses of different tissue lysates using 66605-1-Ig antibody to ERMN detected a 50 kDa single band protein as a result of phosphorylation modification.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag27040 Product name: Recombinant human ERMN protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-257 aa of BC026345 Sequence: MTDVPATFTQAECNGDKPPENGQQTITKISEELTDVDSPLPHYRVEPSLEGALTKGSQEERRKLQGNMLLNSSMEDKMLKENPEEKLFIVHKAITDLSLQETSADEMTFREGHQWEKIPLSGSNQEIRRQKERITEQPLKEEEDEDRKNKGHQAAEIEWLGFRKPSQADMLHSKHDEEQKVWDEEIDDDDDDNCNNDEDEVRVIEFKKKHEEVSQFKEEGDASEDSPLSSASSQAVTPDEQPTLGKKSDISRNAYSR Predict reactive species\nFull Name: ermin, ERM-like protein\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC026345\nGene Symbol: ERMN\nGene ID (NCBI): 57471\nRRID: AB_2881965\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8TAM6\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888041316521,"sku":"66605-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66605-1-ig","provider":"Iright","version":"1.0","type":"link"}