{"product_id":"proteintech-66614-1-ig","title":"Proteintech, 66614-1-Ig, PPP3CB Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe PPP3CB (66614-1-Ig) by Proteintech is a Monoclonal antibody targeting PPP3CB in WB, IF\/ICC, ELISA applications with reactivity to human, mouse, rat, pig samples\n66614-1-Ig targets PPP3CB in WB, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat, pig samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: pig brain tissue, NIH\/3T3 cells,  fetal human brain tissue,  rat brain tissue,  mouse brain tissue\nPositive IF\/ICC detected in: HeLa cells, U-251 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:10000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nPPP3CB is one of the three isoforms of the A subunit of calcineurin (CnA). Calcineurin is a calcium-dependent serine\/threonine phosphatase. It consists of two subunits: subunit A (CnA) and subunit B (CnB). For CnA, three isoforms PPP3CA (CnAα), PPP3CB (CnAβ) and PPP3CC (CnAγ) have been identified. PPP3CB is a calcium-dependent, calmodulin-stimulated protein phosphatase. It may have a role in the calmodulin activation of calcineurin.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat, pig\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26987 Product name: Recombinant human PPP3CB protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 365-525 aa of BC028049 Sequence: FVGEKVTEMLVNVLSICSDDELMTEGEDQFDGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHATENHGTGNHTAQ Predict reactive species\nFull Name: protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform\nCalculated Molecular Weight: 525 aa, 59 kDa\nObserved Molecular Weight: 59 kDa\nGenBank Accession Number: BC028049\nGene Symbol: PPP3CB\nGene ID (NCBI): 5532\nRRID: AB_2881974\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P16298\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888071725225,"sku":"66614-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66614-1-ig","provider":"Iright","version":"1.0","type":"link"}