{"product_id":"proteintech-66620-1-ig","title":"Proteintech, 66620-1-Ig, ADAM10 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ADAM10 (66620-1-Ig) by Proteintech is a Monoclonal antibody targeting ADAM10 in WB, IHC, ELISA applications with reactivity to human samples\n66620-1-Ig targets ADAM10 in WB, IHC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, MCF-7 cells,  Jurkat cells,  K-562 cells\nPositive IHC detected in: human prostate cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:1000-1:6000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nADAM10, a member of the ADAM (a disintegrin and metalloprotease) family, is widely expressed in the brain, the spinal cord, and the visual system during development.MW of premature ADAM10 is 90 kDa and mature ADAM10 is 60-70 kDa (PMID: 24404179).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag23062 Product name: Recombinant human ADAM10 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 306-512 aa of BC126253 Sequence: EQNHDDYCLAYVFTDRDFDDGVLGLAWVGAPSGSSGGICEKSKLYSDGKKKSLNTGIITVQNYGSHVPPKVSHITFAHEVGHNFGSPHDSGTECTPGESKNLGQKENGNYIMYARATSGDKLNNNKFSLCSIRNISQVLEKKRNNCFVESGQPICGNGMVEQGEECDCGYSDQCKDECCFDANQPEGRKCKLKPGKQCSTVCIQVKV Predict reactive species\nFull Name: ADAM metallopeptidase domain 10\nCalculated Molecular Weight: 748 aa, 84 kDa\nObserved Molecular Weight: 90-95 kDa\nGenBank Accession Number: BC126253\nGene Symbol: ADAM10\nGene ID (NCBI): 102\nRRID: AB_2881980\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: O14672\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888035287209,"sku":"66620-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66620-1-ig","provider":"Iright","version":"1.0","type":"link"}