{"product_id":"proteintech-66633-1-ig","title":"Proteintech, 66633-1-Ig, ROCK2(middle) Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe ROCK2(middle) (66633-1-Ig) by Proteintech is a Monoclonal antibody targeting ROCK2(middle) in WB, IHC, ELISA applications with reactivity to human, mouse, rat samples\n66633-1-Ig targets ROCK2(middle) in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HeLa cells, HEK-293 cells,  MCF-7 cells,  Jurkat cells,  HSC-T6 cells,  NIH\/3T3 cells\nPositive IHC detected in: human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:250-1:1000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nROCK2 is a serine\/threonine kinase that regulates cytokinesis, smooth muscle contraction, the formation of actin stress fibers and focal adhesions, and the activation of the c-fos serum response element. It is an isozyme of ROCK1, is a target for the small GTPase Rho. ROCK2 is localized in  both cytoplasm and nucleus, and the nucleus-localized ROCK2 can target p300 for phosphorylation to regulate its acetyltransferase activity (PMID:16574662).This antibody is specific to ROCK2.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nCited Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG2b\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag16330 Product name: Recombinant human ROCK2 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 1-180 aa of BC111801 Sequence: MEIDMTYQLKVIQQSLEQEEAEHKATKARLADKNKIYESIEEAKSEAMKEMEKKLLEERTLKQKVENLLLEAEKRCSLLDCDLKQSQQKINELLKQKDVLNEDVRNLTLKIEQETQKRCLTQNDLKMQTQQVNTLKMSEKQLKQENNHLMEMKMNLEKQNAELRKERQDADGQMKELQDQ Predict reactive species\nFull Name: Rho-associated, coiled-coil containing protein kinase 2\nCalculated Molecular Weight: 77 kDa, 161 kDa\nObserved Molecular Weight: 161 kDa\nGenBank Accession Number: BC111801\nGene Symbol: ROCK2\nGene ID (NCBI): 9475\nRRID: AB_2881992\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: O75116\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887993475241,"sku":"66633-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66633-1-ig","provider":"Iright","version":"1.0","type":"link"}