{"product_id":"proteintech-66664-1-ig","title":"Proteintech, 66664-1-Ig, DDX54 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe DDX54 (66664-1-Ig) by Proteintech is a Monoclonal antibody targeting DDX54 in WB, IF\/ICC, FC (Intra), ELISA applications with reactivity to human, mouse samples\n66664-1-Ig targets DDX54 in WB, IHC, IF\/ICC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: HepG2 cells, LNCaP cells,  HeLa cells,  Jurkat cells,  K-562 cells,  PC-3 cells,  U-251 cells,  U-87 MG cells\nPositive IF\/ICC detected in: PC-3 cells\nPositive FC (Intra) detected in: PC-3 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\nFlow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension\n\u003cb\u003eBackground Information\u003c\/b\u003e\nDDX54, also named as ATP-dependent RNA helicase DDX54, is a 881 amino acid protein, which contains 1 helicase ATP-binding domain and belongs to the DEAD box helicase family. DDX54\/DBP10 subfamily. DDX54 localizes in nucleus and Interacts in a hormone-dependent manner with nuclear receptors. DDX54 has RNA-dependent ATPase activity and represses the transcriptional activity of nuclear receptors.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse\nCited Reactivity: human\nHost \/ Isotype: Mouse \/ IgG2a\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag25289 Product name: Recombinant human DDX54 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 778-881 aa of BC156669 Sequence: DDRDSDEEGASDRRGPERRGGKRDRGQGASRPHAPGTPAGRVRPELKTKQQILKQRRRAQKLHFLQRGGLKQLSARNRRRVQELQQGAFGRGARSKKGKMRKRM Predict reactive species\nFull Name: DEAD (Asp-Glu-Ala-Asp) box polypeptide 54\nCalculated Molecular Weight: 98 kDa\nObserved Molecular Weight: 98 kDa\nGenBank Accession Number: BC156669\nGene Symbol: DDX54\nGene ID (NCBI): 79039\nRRID: AB_2882019\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein A purification\nUNIPROT ID: Q8TDD1\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888060780713,"sku":"66664-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66664-1-ig","provider":"Iright","version":"1.0","type":"link"}