{"product_id":"proteintech-66684-1-ig","title":"Proteintech, 66684-1-Ig, Cytokeratin 13 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe Cytokeratin 13 (66684-1-Ig) by Proteintech is a Monoclonal antibody targeting Cytokeratin 13 in WB, IHC, IF-P, ELISA applications with reactivity to human, rat samples\n66684-1-Ig targets Cytokeratin 13 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, rat skin tissue\nPositive IHC detected in: human cervical cancer tissue, human oesophagus cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF-P detected in: human cervical cancer tissue\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:1000-1:4000\nImmunofluorescence (IF)-P: IF-P : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nKeratins are a large family of proteins that form the intermediate filament cytoskeleton of epithelial cells, which are classified into two major sequence types. Type I keratins are a group of acidic intermediate filament proteins, including K9-K23, and the hair keratins Ha1-Ha8. Type II keratins are the basic or neutral courterparts to the acidic type I keratins, including K1-K8, and the hair keratins, Hb1-Hb6. This type I cytokeratin is paired with keratin 4 and expressed in the suprabasal layers of non-cornified stratified epithelia. The Keratin 13 (KRT13) gene encodes a type I acidic keratin which is expressed in the differentiated cells of non-cornified stratified squamous epithelia. This antibody can react with Cytokeratin 15.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, rat\nCited Reactivity: human, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag0217 Product name: Recombinant human KRT13 protein Source: e coli. -derived, PGEX-4T Tag: GST Domain: 183-458 aa of BC002661 Sequence: ARLAVDDFRLKYENELALRQSVEADINGLRRVLDELTLSKTDLEMQIESLNEELAYMKKNHEEEMKEFSNQVVGQVNVEMDATPGIDLTRVLAEMREQYEAMAERNRRDAEEWFHAKSAELNKEVSTNTAMIQTSKTEITELRRTLQGLEIELQSQLSMKAGLENTVAETECRYALQLQQIQGLISSIEAQLSELRSEMECQNQEYKMLLDIKTRLEQEIATYRSLLEGQDAKMIGFPSSAGSVSPRSTSVTTTSSASVTTTSNASGRRTSDVRRP Predict reactive species\nFull Name: keratin 13\nCalculated Molecular Weight: 50 kDa\nObserved Molecular Weight: 50 kDa\nGenBank Accession Number: BC002661\nGene Symbol: Cytokeratin 13\nGene ID (NCBI): 3860\nRRID: AB_2882038\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P13646\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888060518569,"sku":"66684-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66684-1-ig","provider":"Iright","version":"1.0","type":"link"}