{"product_id":"proteintech-66706-1-ig","title":"Proteintech, 66706-1-Ig, MTAP Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe MTAP (66706-1-Ig) by Proteintech is a Monoclonal antibody targeting MTAP in WB, IHC, IF\/ICC, ELISA applications with reactivity to human, mouse, rat samples\n66706-1-Ig targets MTAP in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: NIH\/3T3 cells, HCT 116 cells,  HSC-T6 cells,  Raji cells,  HT-29 cells\nPositive IHC detected in: mouse liver tissue, human kidney tissue,  rat liver tissue,  mouse kidney tissue,  human colon cancer tissue,  human liver cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: HeLa cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:2000-1:10000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:400-1:1600\n\u003cb\u003eBackground Information\u003c\/b\u003e\nMTAP is a 5-deoxy-5-methylthioadenosine (MTA) phosphorylase, converting MTA to salvageable intermediates including adenine and 5-methylthioribose-1-phosphate. MTAP is abundant in normal cells, but it is frequently found to be deleted in a variety of cancers. Its deficiency is common in cancer cell lines as well as in primary leukemia, lung cancer, melanoma, bladder cancer, gliomas and breast cancer.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human, mouse, rat\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag17954 Product name: Recombinant human MTAP protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 1-154 aa of BC018625 Sequence: MASGTTTTAVKIGIIGGTGLDDPEILEGRTEKYVDTPFGKPSDALILGKIKNVDCILLARHGRQHTIMPSKVNYQANIWALKEEGCTHVIVTTACGSLREEIQPGDIVIIDQFIDSHVRRACFPFTFHHDCFQRPPQKPSRSHCVSCATCRTMS Predict reactive species\nFull Name: methylthioadenosine phosphorylase\nCalculated Molecular Weight: 283 aa, 31 kDa\nObserved Molecular Weight: 31 kDa\nGenBank Accession Number: BC018625\nGene Symbol: MTAP\nGene ID (NCBI): 4507\nRRID: AB_2882058\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: Q13126\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46888295202985,"sku":"66706-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66706-1-ig","provider":"Iright","version":"1.0","type":"link"}