{"product_id":"proteintech-66736-1-ig","title":"Proteintech, 66736-1-Ig, EPHA2 Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe EPHA2 (66736-1-Ig) by Proteintech is a Monoclonal antibody targeting EPHA2 in WB, IF\/ICC, ELISA applications with reactivity to human samples\n66736-1-Ig targets EPHA2 in WB, IHC, IF\/ICC, ELISA applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: A431 cells, HEK-293 cells,  BxPC-3 cells,  MCF-7 cells,  HepG2 cells\nPositive IF\/ICC detected in: HepG2 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:200-1:800\n\u003cb\u003eBackground Information\u003c\/b\u003e\nEPHA2 (Ephrin type-A receptor 2) belongs to the receptor tyrosine kinase (RTK) family, with 16 known receptors and 9 known membrane-bound ligands in all species. Based on the extracellular domain sequence homology, structure, and binding affinity, Eph receptors and their ephrin ligands can be divided into A and B subtypes (PMID: 33962882). EPHA2 contains a conserved N-terminal ligand-bound extracellular domain, a transmembrane domain, and a conserved tyrosine kinase domain (PMID: 8070404).\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, mouse\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag22566 Product name: Recombinant human EPHA2 protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 271-535 aa of BC037166 Sequence: DACQACSPGFFKFEASESPCLECPEHTLPSPEGATSCECEEGFFRAPQDPASMPCTRPPSAPHYLTAVGMGAKVELRWTPPQDSGGREDIVYSVTCEQCWPESGECGPCEASVRYSEPPHGLTRTSVTVSDLEPHMNYTFTVEARNGVSGLVTSRSFRTASVSINQTEPPKVRLEGRSTTSLSVSWSIPPPQQSRVWKYEVTYRKKGDSNSYNVRRTEGFSVTLDDLAPDTTYLVQVQALTQEGQGAGSKVHEFQTLSPEGSGNL Predict reactive species\nFull Name: EPH receptor A2\nCalculated Molecular Weight: 976 aa, 108 kDa\nObserved Molecular Weight: 130 kDa\nGenBank Accession Number: BC037166\nGene Symbol: EPHA2\nGene ID (NCBI): 1969\nRRID: AB_2882086\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P29317\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887994359977,"sku":"66736-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66736-1-ig","provider":"Iright","version":"1.0","type":"link"}