{"product_id":"proteintech-66737-1-ig","title":"Proteintech, 66737-1-Ig, IL-1 beta Monoclonal antibody","description":"Size: 20ul \/ 150ul\nThe IL-1 beta (66737-1-Ig) by Proteintech is a Monoclonal antibody targeting IL-1 beta in WB, IHC, IF\/ICC, ELISA applications with reactivity to human samples\n66737-1-Ig targets IL-1 beta in WB, IHC, IF\/ICC, IP, ELISA, Cell treatment applications and shows reactivity with human samples.\n\u003cb\u003eTested Applications\u003c\/b\u003e\nPositive WB detected in: THP-1 cells, A431 cells,  U-87 MG cells\nPositive IHC detected in: human lung cancer tissue, human skin cancer tissueNote: suggested antigen retrieval withTE buffer pH 9.0;(*) Alternatively, antigen retrieval may be performed withcitrate buffer pH 6.0\nPositive IF\/ICC detected in: LPS treated THP-1 cells\n\u003cb\u003eRecommended dilution\u003c\/b\u003e\nWestern Blot (WB): WB : 1:5000-1:50000\nImmunohistochemistry (IHC): IHC : 1:50-1:500\nImmunofluorescence (IF)\/ICC: IF\/ICC : 1:1000-1:4000\n\u003cb\u003eBackground Information\u003c\/b\u003e\nInterleukin-1 is a pro-inflammatory cytokine with multiple biological effects. The IL-1 gene family encodes three proteins: IL-1α, IL-1β and their naturally occurring inhibitor Il-1RN. IL-1 Beta(IL-1β), mainly produced by blood monocytes and tissue macrophages, has been implicated in mediating both acute and chronic inflammation. IL-1β is known to be involved in a variety of cellular activities, including cell proliferation, differentiation and apoptosis. IL-1β is emerging as a key mediator of carcinogenesis that characterizes host-environment interactions. Human IL-1β is synthesized as a 31 kDa precursor. To gain activity, the precursor must be cleaved by caspase-1 between Asp116 and Ala117 to yield a 17 kDa mature form.\n\u003cb\u003eSpecification\u003c\/b\u003e\nTested Reactivity: human\nCited Reactivity: human, rabbit, bovine\nHost \/ Isotype: Mouse \/ IgG1\nClass: Monoclonal\nType: Antibody\nImmunogen: CatNo: Ag26030 Product name: Recombinant human IL-1B protein Source: e coli. -derived, PET28a Tag: 6*His Domain: 117-269 aa of BC008678 Sequence: APVRSLNCTLRDSQQKSLVMSGPYELKALHLQGQDMEQQVVFSMSFVQGEESNDKIPVALGLKEKNLYLSCVLKDDKPTLQLESVDPKNYPKKKMEKRFVFNKIEINNKLEFESAQFPNWYISTSQAENMPVFLGGTKGGQDITDFTMQFVSS Predict reactive species\nFull Name: interleukin 1, beta\nCalculated Molecular Weight: 269 aa, 31 kDa\nObserved Molecular Weight: 35 kDa\nGenBank Accession Number: BC008678\nGene Symbol: IL1B\nGene ID (NCBI): 3553\nENSEMBL Gene ID: ENSG00000125538\nRRID: AB_2882087\nConjugate: Unconjugated\nForm: Liquid\nPurification Method: Protein G purification\nUNIPROT ID: P01584\nStorage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.\nStorage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20 o C storage. 20ul sizes contain 0.1% BSA.","brand":"Proteintech","offers":[{"title":"Default Title","offer_id":46887972995241,"sku":"66737-1-Ig","price":0.99,"currency_code":"USD","in_stock":true}],"url":"https:\/\/iright.com\/es\/products\/proteintech-66737-1-ig","provider":"Iright","version":"1.0","type":"link"}